PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00025g00312.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 295aa    MW: 33852.4 Da    PI: 7.0245
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00025g00312.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.28e-331972255
                   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              prlrWtp+LH++Fv+a+e+LGG++kAtPk +l++m+v gLt++hvkSHLQ+YR+
  Peaxi162Scf00025g00312.1 19 PRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISHVKSHLQMYRS 72
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.7581575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-311575IPR009057Homeodomain-like
SuperFamilySSF466891.58E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-241973IPR006447Myb domain, plants
PfamPF002495.9E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGNCGRNGGV RQYIRSKVPR LRWTPDLHHC FVHAIEKLGG QDKATPKLVL QMMDVRGLTI  60
SHVKSHLQMY RSMKSDVNRQ ADRSSTLPRK QSLGDSDYHL QEEEEVCVEQ QKLLSYNSSF  120
SPKERSESPH FNSVQPTKRD DYNMHSTMAD NKGENSFIWQ QTTSETERET AHPFCNTIFS  180
QLPQDFFQSF RSNEVQESEI FKTTKQQDEN WKSSKKCKFE SSRKIEHGQE EEECGLSLSL  240
SLHHPSTQRS NTSSTSEISE AISSYSGSNF KYHWVSSSAE KHSVNLDLSI ALCTE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754434e-48HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755164e-48HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766440.11e-141PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLM1CVL01e-108M1CVL0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000756681e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-35G2-like family protein